ZNF70 Polyclonal AntibodyZNF70 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF70 Polyclonal Antibody

Cat# Size Price Qty Buy
A16072-20ul 20ul
£77.00
A16072-50ul 50ul
£113.75
A16072-100ul 100ul
£192.50
A16072-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16072
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF70; Cos17; zinc finger protein 70
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1).
Reactivity Human, Mouse, Rat
Gene ID 7621
Calculated MW 50kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents