ZNF597 Polyclonal AntibodyZNF597 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF597 Polyclonal Antibody

Cat# Size Price Qty Buy
A14452-200ul 200ul
£332.50
A14452-100ul 100ul
£192.50
A14452-50ul 50ul
£113.75
A14452-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14452
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF597; HIT-4; zinc finger protein 597
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF597 (NP_689670.1).
Reactivity Human, Mouse, Rat
Gene ID 146434
Calculated MW 48kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLVELSEYLGTNT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents