ZFAND5 Polyclonal AntibodyZFAND5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZFAND5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13185-200ul 200ul
£332.50
A13185-100ul 100ul
£192.50
A13185-50ul 50ul
£113.75
A13185-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13185
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZFAND5; ZA20D2; ZFAND5A; ZNF216; AN1-type zinc finger protein 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ZFAND5 (NP_001095890.1).
Reactivity Mouse
Gene ID 7763
Calculated MW 23kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPK
Sensitivity WB,1:500 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents