XRCC5 Polyclonal AntibodyXRCC5 Polyclonal Antibody
Move your mouse over image or click to enlarge

XRCC5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13369-200ul 200ul
£332.50
A13369-100ul 100ul
£192.50
A13369-50ul 50ul
£113.75
A13369-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13369
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names XRCC5; KARP-1; KARP1; KU80; KUB2; Ku86; NFIV; X-ray repair cross complementing 5
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 540-732 of human XRCC5 (NP_066964.1).
Reactivity Human
Gene ID 7520
Calculated MW 82kDa
Observed MW 83kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents