WNT2 Polyclonal AntibodyWNT2 Polyclonal Antibody
Move your mouse over image or click to enlarge

WNT2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13562-200ul 200ul
£332.50
A13562-100ul 100ul
£192.50
A13562-50ul 50ul
£113.75
A13562-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13562
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names WNT2; INT1L1; IRP; protein Wnt-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNT2 (NP_003382.1).
Reactivity Mouse, Rat
Gene ID 7472
Calculated MW 40kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents