WBP5 Polyclonal AntibodyWBP5 Polyclonal Antibody
Move your mouse over image or click to enlarge

WBP5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15990-20ul 20ul
£77.00
A15990-50ul 50ul
£113.75
A15990-100ul 100ul
£192.50
A15990-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15990
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TCEAL9; WBP5; WEX6; transcription elongation factor A like 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human WBP5 (NP_057387.1).
Reactivity Human
Gene ID 51186
Calculated MW 12kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents