VPS25 Polyclonal AntibodyVPS25 Polyclonal Antibody
Move your mouse over image or click to enlarge

VPS25 Polyclonal Antibody

Cat# Size Price Qty Buy
A13132-200ul 200ul
£332.50
A13132-100ul 100ul
£192.50
A13132-50ul 50ul
£113.75
A13132-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13132
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names VPS25; DERP9; EAP20; FAP20; vacuolar protein sorting 25 homolog
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1).
Reactivity Human, Mouse, Rat
Gene ID 84313
Calculated MW 20kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents