UQCR10 Polyclonal AntibodyUQCR10 Polyclonal Antibody
Move your mouse over image or click to enlarge

UQCR10 Polyclonal Antibody

Cat# Size Price Qty Buy
A4674-200ul 200ul
£332.50
A4674-100ul 100ul
£192.50
A4674-50ul 50ul
£113.75
A4674-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4674
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UQCR10; HSPC051; HSPC119; HSPC151; QCR9; UCCR7.2; UCRC; cytochrome b-c1 complex subunit 9
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2).
Reactivity Human, Mouse, Rat
Gene ID 29796
Calculated MW 6kDa/7kDa
Observed MW 7kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents