UBL4A Polyclonal AntibodyUBL4A Polyclonal Antibody
Move your mouse over image or click to enlarge

UBL4A Polyclonal Antibody

Cat# Size Price Qty Buy
A4211-200ul 200ul
£332.50
A4211-100ul 100ul
£192.50
A4211-50ul 50ul
£113.75
A4211-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4211
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBL4A; DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4; ubiquitin like 4A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1).
Reactivity Human, Mouse, Rat
Gene ID 8266
Calculated MW 17kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Sensitivity WB,1:200 - 1:1000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents