UBC Polyclonal AntibodyUBC Polyclonal Antibody
Move your mouse over image or click to enlarge

UBC Polyclonal Antibody

Cat# Size Price Qty Buy
A3207-200ul 200ul
£332.50
A3207-100ul 100ul
£192.50
A3207-50ul 50ul
£113.75
A3207-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3207
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names UBC; HMG20; ubiquitin C
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBC (NP_066289.3).
Reactivity Human, Mouse, Rat
Gene ID 7316
Calculated MW 77kDa
Observed MW 12kD/25kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 28143869|27773673|28541289
Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents