TUBG1 Polyclonal AntibodyTUBG1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TUBG1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14554-200ul 200ul
£332.50
A14554-100ul 100ul
£192.50
A14554-50ul 50ul
£113.75
A14554-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14554
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TUBG1; CDCBM4; GCP-1; TUBG; TUBGCP1; tubulin gamma 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TUBG1 (NP_001061.2).
Reactivity Human, Mouse, Rat
Gene ID 7283
Calculated MW 51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQE
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents