TSPYL2 Polyclonal AntibodyTSPYL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSPYL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13118-200ul 200ul
£332.50
A13118-100ul 100ul
£192.50
A13118-50ul 50ul
£113.75
A13118-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13118
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSPYL2; CDA1; CINAP; CTCL; DENTT; HRIHFB2216; NP79; SE204; TSPX; TSPY like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-460 of human TSPYL2 (NP_071400.1).
Reactivity Human, Mouse, Rat
Gene ID 64061
Calculated MW 79kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTD
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents