TSPAN7 Polyclonal AntibodyTSPAN7 Polyclonal Antibody
Move your mouse over image or click to enlarge

TSPAN7 Polyclonal Antibody

Cat# Size Price Qty Buy
A13555-200ul 200ul
£332.50
A13555-100ul 100ul
£192.50
A13555-50ul 50ul
£113.75
A13555-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13555
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSPAN7; A15; CCG-B7; CD231; DXS1692E; MRX58; MXS1; TALLA-1; TM4SF2; TM4SF2b; tetraspanin-7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 113-213 of human TSPAN7 (NP_004606.2).
Reactivity Human
Gene ID 7102
Calculated MW 27kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents