TSHB Polyclonal AntibodyTSHB Polyclonal Antibody
Move your mouse over image or click to enlarge

TSHB Polyclonal Antibody

Cat# Size Price Qty Buy
A14523-200ul 200ul
£332.50
A14523-100ul 100ul
£192.50
A14523-50ul 50ul
£113.75
A14523-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14523
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSHB; TSH-B; TSH-BETA; thyrotropin subunit beta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human TSHB (NP_000540.2).
Reactivity Human, Mouse, Rat
Gene ID 7252
Calculated MW 10kDa/15kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents