TSFM Polyclonal AntibodyTSFM Polyclonal Antibody
Move your mouse over image or click to enlarge

TSFM Polyclonal Antibody

Cat# Size Price Qty Buy
A16094-20ul 20ul
£77.00
A16094-50ul 50ul
£113.75
A16094-100ul 100ul
£192.50
A16094-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16094
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TSFM; EFTS; EFTSMT; elongation factor Ts, mitochondrial
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167).
Reactivity Human, Mouse, Rat
Gene ID 10102
Calculated MW 18kDa/23kDa/35kDa/37kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents