TRIM9 Polyclonal AntibodyTRIM9 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRIM9 Polyclonal Antibody

Cat# Size Price Qty Buy
A13895-200ul 200ul
£332.50
A13895-100ul 100ul
£192.50
A13895-50ul 50ul
£113.75
A13895-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13895
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRIM9; RNF91; SPRING; tripartite motif containing 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TRIM9 (NP_055978.4).
Reactivity Mouse, Rat
Gene ID 114088
Calculated MW 61kDa/79kDa/89kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents