TRAF3IP3 Polyclonal AntibodyTRAF3IP3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TRAF3IP3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15899-20ul 20ul
£77.00
A15899-50ul 50ul
£113.75
A15899-100ul 100ul
£192.50
A15899-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15899
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TRAF3IP3; T3JAM; TRAF3 interacting protein 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-530 of human TRAF3IP3 (NP_079504.2).
Reactivity Mouse, Rat
Gene ID 80342
Calculated MW 40kDa/61kDa/63kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence VLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKLQGADSRDLQMNQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLLQNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAKEKECRELHSELDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents