TNFSF13 Polyclonal AntibodyTNFSF13 Polyclonal Antibody
Move your mouse over image or click to enlarge

TNFSF13 Polyclonal Antibody

Cat# Size Price Qty Buy
A13570-200ul 200ul
£332.50
A13570-100ul 100ul
£192.50
A13570-50ul 50ul
£113.75
A13570-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13570
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNFSF13; APRIL; CD256; TALL-2; TALL2; TNLG7B; TRDL-1; UNQ383/PRO715; ZTNF2; TNF superfamily member 13
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 105-247 of human TNFSF13 (NP_742085.1).
Reactivity Human
Gene ID 8741
Calculated MW 22kDa/24kDa/25kDa/27kDa/36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGL
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents