TNFAIP8L2 Polyclonal AntibodyTNFAIP8L2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TNFAIP8L2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13698-200ul 200ul
£332.50
A13698-100ul 100ul
£192.50
A13698-50ul 50ul
£113.75
A13698-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13698
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNFAIP8L2; TIPE2; TNF alpha induced protein 8 like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2).
Reactivity Mouse
Gene ID 79626
Calculated MW 20kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents