TNFAIP3 Polyclonal AntibodyTNFAIP3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TNFAIP3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13637-200ul 200ul
£332.50
A13637-100ul 100ul
£192.50
A13637-50ul 50ul
£113.75
A13637-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13637
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNFAIP3; A20; AISBL; OTUD7C; TNFA1P2; TNF alpha induced protein 3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TNFAIP3 (NP_006281.1).
Reactivity Human, Rat
Gene ID 7128
Calculated MW 89kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents