TMTC3 Polyclonal AntibodyTMTC3 Polyclonal Antibody
Move your mouse over image or click to enlarge

TMTC3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14601-200ul 200ul
£332.50
A14601-100ul 100ul
£192.50
A14601-50ul 50ul
£113.75
A14601-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14601
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TMTC3; LIS8; SMILE; transmembrane and TPR repeat-containing protein 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 615-914 of human TMTC3 (NP_861448.2).
Reactivity Human
Gene ID 160418
Calculated MW 103kDa/104kDa
Observed MW 104kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELKALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKISSVEGKKIPTESVKEIRGESRQTQIVKTSDNKSQSKSNKQLGKNGDEETPHKTTKDIKEIEKKRVAALKRLEEIERILNGE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents