TLE1 Polyclonal AntibodyTLE1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TLE1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13360-200ul 200ul
£332.50
A13360-100ul 100ul
£192.50
A13360-50ul 50ul
£113.75
A13360-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13360
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TLE1; ESG; ESG1; GRG1; transducin-like enhancer protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 256-355 of human TLE1 (NP_005068.2).
Reactivity Mouse
Gene ID 7088
Calculated MW 83kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence DPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents