TIPARP Polyclonal AntibodyTIPARP Polyclonal Antibody
Move your mouse over image or click to enlarge

TIPARP Polyclonal Antibody

Cat# Size Price Qty Buy
A14329-200ul 200ul
£332.50
A14329-100ul 100ul
£192.50
A14329-50ul 50ul
£113.75
A14329-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14329
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TIPARP; ARTD14; PARP7; pART14; TCDD inducible poly(ADP-ribose) polymerase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human TIPARP (NP_056323.2).
Reactivity Human, Mouse
Gene ID 25976
Calculated MW 76kDa
Observed MW 76kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents