TIMP1 Polyclonal AntibodyTIMP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TIMP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1389-200ul 200ul
£332.50
A1389-100ul 100ul
£192.50
A1389-50ul 50ul
£113.75
A1389-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1389
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TIMP1; CLGI; EPA; EPO; HCI; TIMP; TIMP-1; metalloproteinase inhibitor 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-207 of human TIMP1 (NP_003245.1).
Reactivity Human, Mouse
Gene ID 7076
Calculated MW 23kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents