THEM4 Polyclonal AntibodyTHEM4 Polyclonal Antibody
Move your mouse over image or click to enlarge

THEM4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15940-20ul 20ul
£77.00
A15940-50ul 50ul
£113.75
A15940-100ul 100ul
£192.50
A15940-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15940
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names THEM4; CTMP; thioesterase superfamily member 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2).
Reactivity Human, Mouse
Gene ID 117145
Calculated MW 27kDa
Observed MW 25kDa/27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents