TGM1 Polyclonal AntibodyTGM1 Polyclonal Antibody
Move your mouse over image or click to enlarge

TGM1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13359-200ul 200ul
£332.50
A13359-100ul 100ul
£192.50
A13359-50ul 50ul
£113.75
A13359-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13359
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TGM1; ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK; transglutaminase 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TGM1 (NP_000350.1).
Reactivity Human, Mouse, Rat
Gene ID 7051
Calculated MW 40kDa/89kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents