TFAM Polyclonal AntibodyTFAM Polyclonal Antibody
Move your mouse over image or click to enlarge

TFAM Polyclonal Antibody

Cat# Size Price Qty Buy
A13552-200ul 200ul
£332.50
A13552-100ul 100ul
£192.50
A13552-50ul 50ul
£113.75
A13552-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13552
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TFAM; MTDPS15; MTTF1; MTTFA; TCF6; TCF6L1; TCF6L2; TCF6L3; transcription factor A, mitochondrial
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TFAM (NP_003192.1).
Reactivity Human, Mouse, Rat
Gene ID 7019
Calculated MW 25kDa/29kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEE
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents