TCEB2 Polyclonal AntibodyTCEB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TCEB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13363-200ul 200ul
£332.50
A13363-100ul 100ul
£192.50
A13363-50ul 50ul
£113.75
A13363-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13363
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ELOB; SIII; TCEB2; elongin-B
Applications IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human TCEB2 (NP_009039.1).
Reactivity Human
Gene ID 6923
Calculated MW 13kDa/17kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents