TAPBP Polyclonal AntibodyTAPBP Polyclonal Antibody
Move your mouse over image or click to enlarge

TAPBP Polyclonal Antibody

Cat# Size Price Qty Buy
A13357-200ul 200ul
£332.50
A13357-100ul 100ul
£192.50
A13357-50ul 50ul
£113.75
A13357-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13357
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TAPBP; NGS17; TAPA; TPN; TPSN; tapasin
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-260 of human TAPBP (NP_757345.2).
Reactivity Human, Mouse, Rat
Gene ID 6892
Calculated MW 38kDa/43kDa/47kDa/53kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents