TAP2 Polyclonal AntibodyTAP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

TAP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A1610-20ul 20ul
£77.00
A1610-50ul 50ul
£113.75
A1610-100ul 100ul
£192.50
A1610-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1610
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TAP2; ABC18; ABCB3; APT2; D6S217E; PSF-2; PSF2; RING11; antigen peptide transporter 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 430-680 of human TAP2 (NP_000535.3).
Reactivity Human, Mouse, Rat
Gene ID 6891
Calculated MW 72kDa/75kDa
Observed MW 76kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQAVQRAHQILVLQEGKL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents