TANK Polyclonal AntibodyTANK Polyclonal Antibody
Move your mouse over image or click to enlarge

TANK Polyclonal Antibody

Cat# Size Price Qty Buy
A14501-200ul 200ul
£332.50
A14501-100ul 100ul
£192.50
A14501-50ul 50ul
£113.75
A14501-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14501
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TANK; I-TRAF; ITRAF; TRAF2; TRAF family member associated NFKB activator
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human TANK (NP_597841.1).
Reactivity Mouse, Rat
Gene ID 10010
Calculated MW 13kDa/47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVIS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents