SUN1 Polyclonal AntibodySUN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SUN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16024-20ul 20ul
£77.00
A16024-50ul 50ul
£113.75
A16024-100ul 100ul
£192.50
A16024-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16024
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SUN1; UNC84A; SUN domain-containing protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-278 of human SUN1 (NP_001165416.1).
Reactivity Human, Mouse, Rat
Gene ID 23353
Calculated MW 90kDa
Observed MW 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents