ST14 Polyclonal AntibodyST14 Polyclonal Antibody
Move your mouse over image or click to enlarge

ST14 Polyclonal Antibody

Cat# Size Price Qty Buy
A13549-200ul 200ul
£332.50
A13549-100ul 100ul
£192.50
A13549-50ul 50ul
£113.75
A13549-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13549
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ST14; ARCI11; HAI; MT-SP1; MTSP1; PRSS14; SNC19; TADG15; TMPRSS14; suppression of tumorigenicity 14
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 566-855 of human ST14 (NP_068813.1).
Reactivity Human, Mouse
Gene ID 6768
Calculated MW 94kDa
Observed MW 100kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents