SSTR3 Polyclonal AntibodySSTR3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SSTR3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16071-20ul 20ul
£77.00
A16071-50ul 50ul
£113.75
A16071-100ul 100ul
£192.50
A16071-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16071
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SSTR3; SS-3-R; SS3-R; SS3R; SSR-28; somatostatin receptor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SSTR3 (NP_001042.1).
Reactivity Human, Mouse, Rat
Gene ID 6753
Calculated MW 45kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents