SOD3 Polyclonal AntibodySOD3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SOD3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13935-200ul 200ul
£332.50
A13935-100ul 100ul
£192.50
A13935-50ul 50ul
£113.75
A13935-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13935
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SOD3; EC-SOD; superoxide dismutase 3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SOD3 (NP_003093.2).
Reactivity Human, Mouse, Rat
Gene ID 6649
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYR
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents