SNRPD1 Polyclonal AntibodySNRPD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SNRPD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14493-200ul 200ul
£332.50
A14493-100ul 100ul
£192.50
A14493-50ul 50ul
£113.75
A14493-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14493
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SNRPD1; HsT2456; SMD1; SNRPD; Sm-D1; small nuclear ribonucleoprotein Sm D1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPD1 (NP_008869.1).
Reactivity Mouse
Gene ID 6632
Calculated MW 13kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents