SMYD3 Polyclonal AntibodySMYD3 Polyclonal Antibody
Move your mouse over image or click to enlarge

SMYD3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14516-200ul 200ul
£332.50
A14516-100ul 100ul
£192.50
A14516-50ul 50ul
£113.75
A14516-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14516
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SMYD3; KMT3E; ZMYND1; ZNFN3A1; bA74P14.1; SET and MYND domain containing 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1).
Reactivity Human, Mouse
Gene ID 64754
Calculated MW 29kDa/42kDa/49kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents