SLC7A2 Polyclonal AntibodySLC7A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC7A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14574-200ul 200ul
£332.50
A14574-100ul 100ul
£192.50
A14574-50ul 50ul
£113.75
A14574-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14574
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC7A2; ATRC2; CAT2; HCAT2; solute carrier family 7 member 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC7A2 (NP_001008539.3).
Reactivity Human, Mouse, Rat
Gene ID 6542
Calculated MW 71kDa/75kDa/76kDa
Observed MW 72kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FLAFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLFVAIVLTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents