SLC4A11 Polyclonal AntibodySLC4A11 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC4A11 Polyclonal Antibody

Cat# Size Price Qty Buy
A15910-20ul 20ul
£77.00
A15910-50ul 50ul
£113.75
A15910-100ul 100ul
£192.50
A15910-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15910
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC4A11; BTR1; CDPD1; CHED; CHED2; NABC1; dJ794I6.2; solute carrier family 4 member 11
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_114423.1).
Reactivity Human, Mouse
Gene ID 83959
Calculated MW 45kDa/98kDa/99kDa/103kDa
Observed MW 100kDa/110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents