SLC2A9 Polyclonal AntibodySLC2A9 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC2A9 Polyclonal Antibody

Cat# Size Price Qty Buy
A14592-200ul 200ul
£332.50
A14592-100ul 100ul
£192.50
A14592-50ul 50ul
£113.75
A14592-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14592
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC2A9; GLUT9; GLUTX; UAQTL2; URATv1; solute carrier family 2 member 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SLC2A9 (NP_001001290.1).
Reactivity Human, Mouse
Gene ID 56606
Calculated MW 55kDa/58kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents