SLC29A1 Polyclonal AntibodySLC29A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC29A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13204-200ul 200ul
£332.50
A13204-100ul 100ul
£192.50
A13204-50ul 50ul
£113.75
A13204-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13204
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC29A1; ENT1; equilibrative nucleoside transporter 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC29A1 (NP_001071645.1).
Reactivity Human, Mouse, Rat
Gene ID 2030
Calculated MW 50kDa/58kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ELSESAFGYFITACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFIF
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents