SLC25A38 Polyclonal AntibodySLC25A38 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC25A38 Polyclonal Antibody

Cat# Size Price Qty Buy
A13218-200ul 200ul
£332.50
A13218-100ul 100ul
£192.50
A13218-50ul 50ul
£113.75
A13218-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13218
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC25A38; SIDBA2; solute carrier family 25 member 38
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC25A38 (NP_060345.2).
Reactivity Human, Mouse
Gene ID 54977
Calculated MW 33kDa
Observed MW 33kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITN
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents