SLC22A8 Polyclonal AntibodySLC22A8 Polyclonal Antibody
Move your mouse over image or click to enlarge

SLC22A8 Polyclonal Antibody

Cat# Size Price Qty Buy
A14575-200ul 200ul
£332.50
A14575-100ul 100ul
£192.50
A14575-50ul 50ul
£113.75
A14575-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14575
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SLC22A8; OAT3; solute carrier family 22 member 8
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human SLC22A8 (NP_004245.2).
Reactivity Human, Mouse, Rat
Gene ID 9376
Calculated MW 11kDa/46kDa/49kDa/59kDa/60kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence LTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents