SIRPG Polyclonal AntibodySIRPG Polyclonal Antibody
Move your mouse over image or click to enlarge

SIRPG Polyclonal Antibody

Cat# Size Price Qty Buy
A4832-200ul 200ul
£332.50
A4832-100ul 100ul
£192.50
A4832-50ul 50ul
£113.75
A4832-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4832
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SIRPG; CD172g; SIRP-B2; SIRPB2; SIRPgamma; bA77C3.1; signal-regulatory protein gamma
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2).
Reactivity Human, Mouse
Gene ID 55423
Calculated MW 18kDa/29kDa/38kDa/42kDa
Observed MW 45-50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents