SIAE Polyclonal AntibodySIAE Polyclonal Antibody
Move your mouse over image or click to enlarge

SIAE Polyclonal Antibody

Cat# Size Price Qty Buy
A13217-200ul 200ul
£332.50
A13217-100ul 100ul
£192.50
A13217-50ul 50ul
£113.75
A13217-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13217
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SIAE; AIS6; CSE-C; CSEC; LSE; YSG2; sialate O-acetylesterase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human SIAE (NP_733746.1).
Reactivity Human
Gene ID 54414
Calculated MW 54kDa/58kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents