SFRS9 Polyclonal AntibodySFRS9 Polyclonal Antibody
Move your mouse over image or click to enlarge

SFRS9 Polyclonal Antibody

Cat# Size Price Qty Buy
A13265-200ul 200ul
£332.50
A13265-100ul 100ul
£192.50
A13265-50ul 50ul
£113.75
A13265-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13265
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SRSF9; SFRS9; SRp30c; serine/arginine-rich splicing factor 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human SFRS9 (NP_003760.1).
Reactivity Human
Gene ID 8683
Calculated MW 25kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents