SESN2 Polyclonal AntibodySESN2 Polyclonal Antibody
Move your mouse over image or click to enlarge

SESN2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14220-200ul 200ul
£332.50
A14220-100ul 100ul
£192.50
A14220-50ul 50ul
£113.75
A14220-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14220
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SESN2; HI95; SES2; SEST2; sestrin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-480 of human SESN2 (NP_113647.1).
Reactivity Human, Mouse
Gene ID 83667
Calculated MW 54kDa
Observed MW 62kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents