SERPINB13 Polyclonal AntibodySERPINB13 Polyclonal Antibody
Move your mouse over image or click to enlarge

SERPINB13 Polyclonal Antibody

Cat# Size Price Qty Buy
A13744-200ul 200ul
£332.50
A13744-100ul 100ul
£192.50
A13744-50ul 50ul
£113.75
A13744-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13744
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SERPINB13; HSHUR7SEQ; HUR7; PI13; headpin; serpin B13
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SERPINB13 (NP_036529.1).
Reactivity Human, Mouse, Rat
Gene ID 5275
Calculated MW 38kDa/44kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents