SAA1 Polyclonal AntibodySAA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SAA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14553-200ul 200ul
£332.50
A14553-100ul 100ul
£192.50
A14553-50ul 50ul
£113.75
A14553-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14553
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SAA1; PIG4; SAA; SAA2; TP53I4; serum amyloid A1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAA1 (NP_000322.2).
Reactivity Mouse, Rat
Gene ID 6288
Calculated MW 13kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAA
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents