RXFP4 Polyclonal AntibodyRXFP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

RXFP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15978-20ul 20ul
£77.00
A15978-50ul 50ul
£113.75
A15978-100ul 100ul
£192.50
A15978-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15978
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RXFP4; GPCR142; GPR100; RLN3R2; RXFPR4; relaxin-3 receptor 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1).
Reactivity Human, Mouse
Gene ID 339403
Calculated MW 41kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents